PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000298965
Common NameNAC18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 362aa    MW: 41799.6 Da    PI: 4.8344
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000298965genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.21.1e-5581371129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++     ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v+
  MDP0000298965   8 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQErcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKSVY 102
                    69****************************.9***************953432233667************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                    + k +l+g++ktLvfykgrap+g+ktdW+mheyrle
  MDP0000298965 103 D-KAKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 137
                    *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-586175IPR003441NAC domain
PROSITE profilePS5100558.1448175IPR003441NAC domain
PfamPF023654.8E-299136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MESIEXTVPP GFRFHPTDEE LVGYYLRKKV ASQKIDLDVI RDIDLYRIEP WDLQERCRIG  60
YEEQNEWYFF SHKDKKYPTG TRTNRATMAG FWKATGRDKS VYDKAKLIGM RKTLVFYKGR  120
APNGQKTDWI MHEYRLESDE NGPPQAKRKL QKLIKENACI CIKEEGWVVC RAFKKRISSQ  180
NKSIEGWDSS YFYEELNGLT SVADPTDFMI SRQPQSFLSQ NFMCKQETEA DSLNFLHSDP  240
FVQLPQLESP SLPLIKRPTS MSLISENNTE LEDEQSIRGC NNAEKVTDWR ALDKFVASQL  300
SQEERYEGDG EASFGAHDES DMSLLLLQSS SARDDDDQVE NKLNGFLNSS PDCDIGICIF  360
EK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-51517612169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280867.10.0NAC domain-containing protein 7-like
SwissprotQ9SL411e-155NAC37_ARATH; NAC domain-containing protein 37
TrEMBLD9ZJ950.0D9ZJ95_MALDO; NAC domain class transcription factor
STRINGVIT_04s0023g03110.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45653459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-143vascular related NAC-domain protein 1